A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10121 |
| Swiss-prot Accession number | Q2Q1P1 (Sequence in FASTA format) |
| Description | Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain). |
| Source organism | Gorilla gorilla gorilla (Lowland gorilla) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Gorilla. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
| Protein Length | 141 Amino acids |
| Molecular weight | 15262 |
| References | 1 Hallast P., Rull K., Laan M.; "What is the evidence for the functionality of CGB1 and CGB2?"; Submitted (OCT-2005) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Cys_knot |
| Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
| Mature Hormone Sequence | SREPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMMRVLQGVLPPLPQVVCTYRDVRFESIXLPGCPRGVDPMVSFPVALSCRCGPCHRSTSDCGGPNDHPLTCDHPQLSGLLFL |
| Position of mature hormone in Pre-Hormone protein | 121 Residues from position (21-141) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |