A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10124 |
| Swiss-prot Accession number | Q9BDI9 (Sequence in FASTA format) |
| Description | Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain). |
| Source organism | Panthera tigris altaica (Siberian tiger) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Pantherinae; Panthera. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
| Protein Length | 142 Amino acids |
| Molecular weight | 15117 |
| References | 1 PubMed abstract 12493701 2 Liao M., Zhu M., Zhang A.; "Cloning of follicle-stimulating hormone (FSH) and luteinizing hormone(LH) genes in Panthera tigris altaica."; Submitted (AUG-2002) to the EMBL/GenBank/DDBJ databases. |
| Domain Name | Cys_knot |
| Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
| Mature Hormone Sequence | SRGPLRPLCRPINATLAAENEACPVCVTFTTTICAGYCPSMMRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPVVSFPVALSCRCGPCRLSSSDCGGPRAQPLACDRPPLPGLPFL |
| Position of mature hormone in Pre-Hormone protein | 121 Residues from position (22-142) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |