A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10126 |
| Swiss-prot Accession number | Q6IY74 (Sequence in FASTA format) |
| Description | Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain). |
| Source organism | Oryctolagus cuniculus (Rabbit) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
| Protein Length | 141 Amino acids |
| Molecular weight | 14752 |
| References | 1 Suzuki O.; "Rabbit luteinizing hormone gene."; Submitted (APR-2004) to the EMBL/GenBank/DDBJ databases.
2 Glenn S.D., Nahm H.S., Ward D.N.; "The amino acid sequence of the rabbit lutropin beta subunit."; J. Protein Chem. 3:259-273(1984). |
| Domain Name | Cys_knot |
| Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
| Mature Hormone Sequence | QAPRGPLRPLCRPVNATLAAENEACPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELRFASIRLPGCPPGVDPEVSFPVALSCRCGPCRLSSSDCGGPRAQPLACDLPHLPGLLFL |
| Position of mature hormone in Pre-Hormone protein | 123 Residues from position (19-141) |
| Receptor | N/A |
| Gene ID | 100009427 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |