A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10127 |
| Swiss-prot Accession number | P80664 (Sequence in FASTA format) |
| Description | Lutropin subunit beta (Luteinizing hormone subunit beta) (LSH-beta)(LSH-B) (LH-B) (Lutropin beta chain). |
| Source organism | Struthio camelus (Ostrich) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
| Protein Length | 128 Amino acids |
| Molecular weight | 12856 |
| References | 1 PubMed abstract 8925835 |
| Domain Name | Cys_knot |
| Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
| Mature Hormone Sequence | VPLGVPVALGVPPSRPPCRPVNVTVAAEKDECPQCLAVTTTACGGYCRTREPVYRSPLGGPAQQACGYGALRYERLALPGCAPGADPTVAVPVALSCRCARCPMATADCTVAGLGPAFCGAPAGFGPQ |
| Position of mature hormone in Pre-Hormone protein | 128 Residues from position (1-128) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |