A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10131 |
| Swiss-prot Accession number | Q10987 (Sequence in FASTA format) |
| Description | Molt-inhibiting hormone precursor (MIH) (Fragment). |
| Source organism | Procambarus bouvieri (Mexican crayfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Cambaridae; Procambarus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops |
| Protein Length | 74 Amino acids |
| Molecular weight | 8530 |
| References | 1 Aguilar-Gaytan R., Cerbon M.A., Cevallos M.A., Huberman A.; Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 8735961 |
| Domain Name | Crust_neurohorm |
| Hormone Name | Molt-inhibiting hormone |
| Mature Hormone Sequence | QVFDQACKGIYDRAIFKKLELVCDDCYNLYRKPKVATTCRENCYANSVFRQCLDDLLLINVVDEYISGVQIV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (1-72) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |