A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10142 |
| Swiss-prot Accession number | Q91221 (Sequence in FASTA format) |
| Description | Somatotropin-2 precursor (Somatotropin II) (Growth hormone II). |
| Source organism | Oncorhynchus nerka (Sockeye salmon) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
| Protein Length | 210 Amino acids |
| Molecular weight | 23938 |
| References | 1 Devlin R.H.; "Sequence of sockeye salmon type 1 and 2 growth hormone genes and therelationship of rainbow trout with Atlantic and Pacific salmon."; Can. J. Fish. Aquat. Sci. 50:1738-1748(1993).
|
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin-2 (Somatotropin II) (Growth hormone II) |
| Mature Hormone Sequence | MENQRLFNIAVNRVQHLHLLAQKMFNDFEGTLLSDERRQLNKIFLLDFCNSDSIVSPIDKQETQKSSVLKLLRISFRLIESWEYPSQTLTISNSLMVRNSNQISEKLSDLKVGINLLIEGSQEGILSLDDNDSQHLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL |
| Position of mature hormone in Pre-Hormone protein | 188 Residues from position (23-210) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |