A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10167 |
| Swiss-prot Accession number | P83627 (Sequence in FASTA format) |
| Description | Vitellogenesis-inhibiting hormone (VIH). |
| Source organism | Armadillidium vulgare (Woodlice) (Pillbugs) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Peracarida; Isopoda; Oniscidea; Armadillidiidae;Armadillidium. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Found in the sinus glands of both male and female. Found also in the brain; the neuroendocrine structures of the protocerebrum |
| Post translational modification | N/A |
| Function | Inhibits secondary vitellogenesis in females. Has no hyperglycemic or molt-inhibiting activity |
| Protein Length | 83 Amino acids |
| Molecular weight | 9491 |
| References | 1 PubMed abstract 10480992 2 PubMed abstract 12679090 |
| Domain Name | Crust_neurohorm |
| Hormone Name | Vitellogenesis-inhibiting hormone |
| Mature Hormone Sequence | YNIPLGWGRRDMPGCLGVLGNRDLYDDVSRICSDCQNVFRDKNVESKCRSDCFSTSYFETCIMALDLAEKISDYKLHASILKE |
| Position of mature hormone in Pre-Hormone protein | 83 Residues from position (1-83) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |