A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10185 |
| Swiss-prot Accession number | Q91XI3 (Sequence in FASTA format) |
| Description | Insulin precursor [Contains: Insulin B chain; Insulin A chain]. |
| Source organism | Spermophilus tridecemlineatus (Thirteen-lined ground squirrel) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Sciuridae; Xerinae; Marmotini; Spermophilus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
| Protein Length | 110 Amino acids |
| Molecular weight | 12004 |
| References | 1 Tredrea M.M., Buck M.J., Guhaniyogi J., Squire T.L., Andrews M.T.; "Regulation of PDK4 expression in a hibernating mammal."; Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Insulin |
| Hormone Name | Insulin B chain |
| Mature Hormone Sequence | FVNQHLCGSHLVEALYLVCGERGFFYTPKS |
| Position of mature hormone in Pre-Hormone protein | 30 Residues from position (25-54) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |