A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10192 |
| Swiss-prot Accession number | P87352 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Gamma-melanotropin-like segment; Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Melanotropin beta(Beta-MSH); Beta-endorphin; Met-enkephalin]. |
| Source organism | Acipenser transmontanus (White sturgeon) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Chondrostei; Acipenseriformes; Acipenseridae;Acipenser. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | N/A |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | Precursor protein for pituitary hormones that regulate stress and environmental adaptation |
| Protein Length | 263 Amino acids |
| Molecular weight | 30163 |
| References | 1 PubMed abstract 9016801 2 PubMed abstract 9016801 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Beta-endorphin |
| Mature Hormone Sequence | YGGFMKSWDERSQKPLLTLFKNVMIKDGHEKKGQ |
| Position of mature hormone in Pre-Hormone protein | 34 Residues from position (230-263) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |