A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10206 |
| Swiss-prot Accession number | Q9BDJ0 (Sequence in FASTA format) |
| Description | Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain). |
| Source organism | Panthera tigris altaica (Siberian tiger) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Pantherinae; Panthera. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Stimulates development of follicle and spermatogenesis in the reproductive organs |
| Protein Length | 129 Amino acids |
| Molecular weight | 14655 |
| References | 1 PubMed abstract 12493701 2 Liao M., Zhu M., Zhang A.; "Cloning of follicle-stimulating hormone (FSH) and luteinizing hormone(LH) genes in Panthera tigris altaica."; Submitted (AUG-2002) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 12493701 4 Liao M., Zhu M., Zhang A.; "Cloning of follicle-stimulating hormone (FSH) and luteinizing hormone(LH) genes in Panthera tigris altaica."; Submitted (AUG-2002) to the EMBL/GenBank/DDBJ databases. |
| Domain Name | Cys_knot |
| Hormone Name | Follicle-stimulating hormone beta subunit |
| Mature Hormone Sequence | KSCELTNITITVEKEECRFCMSINATWCAGYCYTRDLVYKDPARPNNQKTCTFKELVYETVKVPGCAHQADSLYTYPVATECHCGKCDSDSTDCTVQGLGPSYCSFSEMKE |
| Position of mature hormone in Pre-Hormone protein | 111 Residues from position (19-129) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |