A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10207 |
| Swiss-prot Accession number | Q2PUH2 (Sequence in FASTA format) |
| Description | Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain). |
| Source organism | Pan troglodytes (Chimpanzee) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Stimulates development of follicle and spermatogenesis in the reproductive organs |
| Protein Length | 129 Amino acids |
| Molecular weight | 14660 |
| References | 1 Grigorova M., Laan M.; "FSHB gene has two major haplotypes."; Submitted (NOV-2005) to the EMBL/GenBank/DDBJ databases.
2 Grigorova M., Laan M.; "FSHB gene has two major haplotypes."; Submitted (NOV-2005) to the EMBL/GenBank/DDBJ databases. |
| Domain Name | Cys_knot |
| Hormone Name | Follicle-stimulating hormone beta subunit |
| Mature Hormone Sequence | CELTNITIAIEKEECRFCISINTTWCAGHCYTRDLVYKDPARPNIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE |
| Position of mature hormone in Pre-Hormone protein | 109 Residues from position (21-129) |
| Receptor | N/A |
| Gene ID | 736618 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |