A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10209 |
| Swiss-prot Accession number | Q9PS36 (Sequence in FASTA format) |
| Description | Follitropin subunit beta (Follicle-stimulating hormone beta subunit)(FSH-beta) (FSH-B) (Follitropin beta chain). |
| Source organism | Rana catesbeiana (Bull frog) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Stimulates development of follicle and spermatogenesis in the reproductive organs |
| Protein Length | 107 Amino acids |
| Molecular weight | 11794 |
| References | 1 PubMed abstract 1426958 2 PubMed abstract 1426958 |
| Domain Name | Cys_knot |
| Hormone Name | Follicle-stimulating hormone beta subunit |
| Mature Hormone Sequence | CELSNITIVLEKEECGACVSVNATWCSGYCYTKDANLMYPQKSEKQGVCTYTEVIYETVKIPGCAENVNPFYTYPVAVDCHCGRCDSETTDCTVRALGPTYCSLSQD |
| Position of mature hormone in Pre-Hormone protein | 107 Residues from position (1-107) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |