A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10218 |
| Swiss-prot Accession number | Q9ERJ6 (Sequence in FASTA format) |
| Description | Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha). |
| Source organism | Meriones unguiculatus (Mongolian jird) (Mongolian gerbil) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Gerbillinae; Meriones. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 120 Amino acids |
| Molecular weight | 13473 |
| References | 1 PubMed abstract 12112597 2 PubMed abstract 12112597 |
| Domain Name | Hormone_6 |
| Hormone Name | Glycoprotein hormones alpha chain |
| Mature Hormone Sequence | LPDGDFIIQGCPECKLKENKYFSKGGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKSFTKATVMGNARVENHTECHCSTCYYHKS |
| Position of mature hormone in Pre-Hormone protein | 96 Residues from position (25-120) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |