A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10220 |
| Swiss-prot Accession number | Q6YNX4 (Sequence in FASTA format) |
| Description | Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha). |
| Source organism | Monodelphis domestica (Short-tailed gray opossum) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 120 Amino acids |
| Molecular weight | 13513 |
| References | 1 Kacsoh B.; "Cloning and characterization of the cDNA encoding the anteriorpituitary glycoprotein hormone common alpha subunit in the marsupial,Monodelphis domestica."; Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases.
2 Kacsoh B.; "Cloning and characterization of the cDNA encoding the anteriorpituitary glycoprotein hormone common alpha subunit in the marsupial,Monodelphis domestica."; Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases. |
| Domain Name | Hormone_6 |
| Hormone Name | Glycoprotein hormones alpha chain |
| Mature Hormone Sequence | FPDGEFIMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS |
| Position of mature hormone in Pre-Hormone protein | 96 Residues from position (25-120) |
| Receptor | N/A |
| Gene ID | 554198 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |