A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10223 |
| Swiss-prot Accession number | Q98848 (Sequence in FASTA format) |
| Description | Gonadotropin subunit beta-1 precursor (Gonadotropin beta-I chain)(GTH-I-beta) (Follicle-stimulating hormone-like GTH). |
| Source organism | Carassius auratus (Goldfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Involved in gametogenesis and steroidogenesis |
| Protein Length | 130 Amino acids |
| Molecular weight | 14423 |
| References | 1 PubMed abstract 9073500 2 PubMed abstract 9831661 3 PubMed abstract 9073500 4 PubMed abstract 9831661 |
| Domain Name | Cys_knot |
| Hormone Name | Gonadotropin subunit beta-1 |
| Mature Hormone Sequence | GSECRSSCRLTNISITVESEECGSCITIDTTACAGLCKTQESVYRSPLMLSYQNTCNFREWTYETYEFKGCPARADSIFTYPVALSCECSKCNSDITDCGVLSQQTLGCNAH |
| Position of mature hormone in Pre-Hormone protein | 112 Residues from position (19-130) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |