A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10234 |
| Swiss-prot Accession number | Q9I980 (Sequence in FASTA format) |
| Description | Thymosin beta-10 (Thymb10). |
| Source organism | Torpedo marmorata (Marbled electric ray) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Pristiorajea; Batoidea;Torpediniformes; Torpedinoidei; Torpedinidae; Torpedo. |
| Subcellular location | Cytoplasm (By similarity) |
| Developmental Stage | N/A |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Protein Length | 44 Amino acids |
| Molecular weight | 4916 |
| References | 1 O'Regan S., Matz V., Cha N., Meunier F.M.; "Torpedo electric lobe cDNAs that suppress a choline metabolismmutation in yeast."; Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Thymosin |
| Hormone Name | Thymosin beta-10 |
| Mature Hormone Sequence | ADKPDFGEVASFDKSKLKKTDTEVKNTLPTKETIDQEKKAESS |
| Position of mature hormone in Pre-Hormone protein | 43 Residues from position (2-44) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |