A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10244 |
| Swiss-prot Accession number | Q9I954 (Sequence in FASTA format) |
| Description | Thymosin beta-b. |
| Source organism | Cyprinus carpio (Common carp) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
| Subcellular location | Cytoplasm (By similarity) |
| Developmental Stage | N/A |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Protein Length | 43 Amino acids |
| Molecular weight | 4970 |
| References | 1 Fujiki K., Nakao M., Shin D., Yano T.; "Molecular cloning of carp (Cyprinus carpio) thymosin beta b."; Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Thymosin |
| Hormone Name | Thymosin beta-b |
| Mature Hormone Sequence | ADKPDISEVSQFDKTKLKKTETQEKNTLPTKETIEQEKQCEA |
| Position of mature hormone in Pre-Hormone protein | 42 Residues from position (2-43) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |