A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10250 |
| Swiss-prot Accession number | Q9PUR1 (Sequence in FASTA format) |
| Description | Glucagon-1 precursor [Contains: Glucagon-1 (Glucagon I); Glucagon-likepeptide 1-I (GLP-1I); Glucagon-like peptide 2-I (GLP-2I)]. |
| Source organism | Petromyzon marinus (Sea lamprey) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
| Protein Length | 160 Amino acids |
| Molecular weight | 18042 |
| References | 1 PubMed abstract 10555286 2 PubMed abstract 8405897 |
| Domain Name | Hormone_2 |
| Hormone Name | Glucagon-like peptide 2-I |
| Mature Hormone Sequence | HAEDVNALLDRTMAKTFIEWLEKQNSNDQTD |
| Position of mature hormone in Pre-Hormone protein | 31 Residues from position (130-160) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |