A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10253 |
| Swiss-prot Accession number | P81027 (Sequence in FASTA format) |
| Description | Glucagon-2 (Glucagon II). |
| Source organism | Oreochromis niloticus (Nile tilapia) (Tilapia nilotica) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Labroidei;Cichlidae; African cichlids; Pseudocrenilabrinae; Tilapiini;Oreochromis. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
| Protein Length | 33 Amino acids |
| Molecular weight | 3731 |
| References | 1 PubMed abstract 7656183 |
| Domain Name | Hormone_2 |
| Hormone Name | Glucagon-2 |
| Mature Hormone Sequence | HAGTYTSDVSSYLQDQAAKEFVSWLKTGRGRRD |
| Position of mature hormone in Pre-Hormone protein | 33 Residues from position (1-33) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |