A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10255 |
| Swiss-prot Accession number | Q9PUR0 (Sequence in FASTA format) |
| Description | Glucagon-2 precursor [Contains: Glucagon-2 (Glucagon II) (Glu II);Glucagon-like peptide 2-II (GLP-2II)]. |
| Source organism | Petromyzon marinus (Sea lamprey) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 120 Amino acids |
| Molecular weight | 13397 |
| References | 1 PubMed abstract 10555286 |
| Domain Name | Hormone_2 |
| Hormone Name | Glucagon-like peptide 2-II |
| Mature Hormone Sequence | HSDGSFTNDMNVMLDRMSAKNFLEWLKQQGRG |
| Position of mature hormone in Pre-Hormone protein | 32 Residues from position (89-120) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |