A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10274 |
| Swiss-prot Accession number | Q9PRR0 (Sequence in FASTA format) |
| Description | Somatostatin precursor [Contains: Somatostatin-35; Somatostatin-14](Fragment). |
| Source organism | Lampetra fluviatilis (River lamprey) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Lampetra. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatostatin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Somatostatin inhibits the release of somatotropin |
| Protein Length | 35 Amino acids |
| Molecular weight | 3584 |
| References | 1 PubMed abstract 8575665 |
| Domain Name | Somatostatin |
| Hormone Name | Somatostatin-35 |
| Mature Hormone Sequence | AAAAPGAAGGAQLPLGNRERKAGCKNFFWKTFSSC |
| Position of mature hormone in Pre-Hormone protein | 35 Residues from position (1-35) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |