A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10280 |
| Swiss-prot Accession number | Q9PU29 (Sequence in FASTA format) |
| Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 70(CCK70); Cholecystokinin 8 (CCK8); Cholecystokinin 7 (CCK7)]. |
| Source organism | Struthio camelus (Ostrich) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | Highly concentrated in the duodenum. Also localized in more distal parts of the small intestine |
| Post translational modification | The precursor is cleaved by enzymes to produce a number of active cholecystokinins. |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear |
| Protein Length | 130 Amino acids |
| Molecular weight | 14273 |
| References | 1 PubMed abstract 11072120 |
| Domain Name | Gastrin |
| Hormone Name | Cholecystokinin-70 |
| Mature Hormone Sequence | APSSAGPLKPVPRLDGSIDQRANIGALLAKYLQQARKGPTGRISVMGNRVQSIDPTHRINDRDYMGWMDF |
| Position of mature hormone in Pre-Hormone protein | 70 Residues from position (49-118) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |