A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10294 |
| Swiss-prot Accession number | Q64171 (Sequence in FASTA format) |
| Description | Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain]. |
| Source organism | Mesocricetus auratus (Golden hamster) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Cricetidae; Cricetinae; Mesocricetus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. It bears mature young, and allows separation of the pelvic bones |
| Protein Length | 177 Amino acids |
| Molecular weight | 20007 |
| References | 1 PubMed abstract 7492700 |
| Domain Name | Insulin |
| Hormone Name | Relaxin B chain |
| Mature Hormone Sequence | RVTKEWLDEVIHVCGREYVRAILDICAATVGLEAPPL |
| Position of mature hormone in Pre-Hormone protein | 37 Residues from position (23-59) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |