A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10329 |
| Swiss-prot Accession number | Q6EV79 (Sequence in FASTA format) |
| Description | Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain). |
| Source organism | Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. |
| Subcellular location | Secreted (By similarity) |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Stimulates development of follicle and spermatogenesis in the reproductive organs |
| Protein Length | 129 Amino acids |
| Molecular weight | 14644 |
| References | 1 PubMed abstract 10612425 2 PubMed abstract 10612425 |
| Domain Name | Cys_knot |
| Hormone Name | Follicle-stimulating hormone beta subunit |
| Mature Hormone Sequence | NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKEVVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFSEMKE |
| Position of mature hormone in Pre-Hormone protein | 111 Residues from position (19-129) |
| Receptor | P32212
Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |