A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10344 |
| Swiss-prot Accession number | Q95MI6 (Sequence in FASTA format) |
| Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
| Source organism | Bos taurus (Bovine) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
| Protein Length | 190 Amino acids |
| Molecular weight | 20739 |
| References | 1 Buchanan F.C., Thue T.D., Schmutz S.M.; "Sequence analysis of bovine corticotrophin-releasing hormone - acandidate gene for post-natal growth."; Submitted (JAN-2001) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | CRF |
| Hormone Name | Corticoliberin |
| Mature Hormone Sequence | SQEPPISLDLTFHLLREVLEMTKADQLAQQAHXNRKLLDIA |
| Position of mature hormone in Pre-Hormone protein | 41 Residues from position (148-188) |
| Receptor | Q9BGU4
Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |