A database of hormones and their receptors

Peptide Hormone

HMRbase accession number	10358
Swiss-prot Accession number	Q9JKM4 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Cavia porcellus (Guinea pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues
Protein Length	216 Amino acids
Molecular weight	24822
References	1 Odorico D.M., Fuller P.J., Herington A.C.; "Cloning and sequence of guinea pig growth hormone (GH)."; Submitted (FEB-2000) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	FPAMPLSSLFGNAVLRAQHLHQLAADTYKEFERTYIPEGQRYSIHNTQTAFCFSETIPAPTDKEEAQQRSDVELLHFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGTPRAGQILKQTYDKFDTNLRSNDALLKNYGLLSCFRKDLHRTETYLRVMKCRRFVESSCAF
Position of mature hormone in Pre-Hormone protein	190 Residues from position (27-216)
Receptor	Q9JI97 Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments