A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10359 |
| Swiss-prot Accession number | Q9PTS1 (Sequence in FASTA format) |
| Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
| Source organism | Carassius auratus (Goldfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
| Protein Length | 162 Amino acids |
| Molecular weight | 18418 |
| References | 1 PubMed abstract 10603283 |
| Domain Name | CRF |
| Hormone Name | Corticoliberin |
| Mature Hormone Sequence | SEEPPISLDLTFHLLREVLEMARAEQMAQQAHSNRKMMEIF |
| Position of mature hormone in Pre-Hormone protein | 41 Residues from position (120-160) |
| Receptor | Q49MT7 Detail in HMRbase Q49MT8 Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |