A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10415 |
| Swiss-prot Accession number | P06884 (Sequence in FASTA format) |
| Description | Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; Pancreatic icosapeptide] (Fragment). |
| Source organism | Felis silvestris catus (Cat) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions |
| Protein Length | 66 Amino acids |
| Molecular weight | 7483 |
| References | 1 PubMed abstract 3827854 |
| Domain Name | Hormone_3 |
| Hormone Name | Pancreatic hormone |
| Mature Hormone Sequence | APLEPVYPGDNATPEQMAQYAAELRRYINMLTRPRY |
| Position of mature hormone in Pre-Hormone protein | 36 Residues from position (1-36) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |