A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10445 |
| Swiss-prot Accession number | P19209 (Sequence in FASTA format) |
| Description | Somatostatin precursor [Contains: Somatostatin-34; Somatostatin-14](Fragment). |
| Source organism | Myxine glutinosa (Atlantic hagfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Hyperotreti; Myxiniformes;Myxinidae; Myxininae; Myxine. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatostatin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Somatostatin inhibits the release of somatotropin |
| Protein Length | 34 Amino acids |
| Molecular weight | 3963 |
| References | 1 PubMed abstract 2896118 |
| Domain Name | Somatostatin |
| Hormone Name | Somatostatin-34 |
| Mature Hormone Sequence | AVERPRQDGQVHEPPGRERKAGCKNFFWKTFTSC |
| Position of mature hormone in Pre-Hormone protein | 34 Residues from position (1-34) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |