A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10448 |
| Swiss-prot Accession number | P22077 (Sequence in FASTA format) |
| Description | Somatotropin precursor (Growth hormone). |
| Source organism | Meleagris gallopavo (Common turkey) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | Pituitary gland |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control |
| Protein Length | 216 Amino acids |
| Molecular weight | 24747 |
| References | 1 PubMed abstract 2125220 2 PubMed abstract 2018514 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | TFPTMPLSNLFTNAVLRAQHLHLLAAETYKEFERTYIPEDQRYTNKNSQAAFCYSETIPAPTGKDDAQQKSDMELLRFSLVLIQSWLTPMQYLSKVFTNNLVFGTSDRVFEKLKDLEEGIQALMRELEDRSPRGPQLLRPTYDRFDIHLRSEDALLKNYGLLSCFKKDLHKVETYLKVMKCRRFGESNCNI |
| Position of mature hormone in Pre-Hormone protein | 191 Residues from position (26-216) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |