A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10571 |
| Swiss-prot Accession number | O15980 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormones 1 precursor (Pej-SGP-I) [Contains:CHH precursor-related peptide 1 (CPRP 1); Crustacean hyperglycemichormone 1 (CHH 1)]. |
| Source organism | Penaeus japonicus (Kuruma prawn) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Marsupenaeus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released |
| Post translational modification | N/A |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Protein Length | 120 Amino acids |
| Molecular weight | 13298 |
| References | 1 Ohira T., Watanabe T., Nagasawa H., Aida K.; "Molecular cloning of cDNAs encoding four crustacean hyperglycemichormones and a molt-inhibiting hormone from the kuruma prawn Penaeusjaponicus."; (In) Proceedings of the XIII international congress of comparativeendocrinology, pp.83-86, Yokohama (1998).
2 PubMed abstract 9210164 3 Yang W.-J., Aida K., Nagasawa H.; "Amino acid sequences of a hyperglycaemic hormone and its relatedpeptides from the kuruma prawn, Penaeus japonicus."; Aquaculture 135:205-212(1995). |
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormone 1 |
| Mature Hormone Sequence | SLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVATECRSNCYNNPVFRQCMAYVVPAHLHNEHREAVQMV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (47-118) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |