A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10573 |
| Swiss-prot Accession number | O97384 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormones 2 precursor (Pm-SGP-II) [Contains:CHH precursor-related peptide 2 (CPRP 2); Crustacean hyperglycemichormone 2 (CHH 2)]. |
| Source organism | Penaeus monodon (Penoeid shrimp) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Penaeus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Protein Length | 118 Amino acids |
| Molecular weight | 13137 |
| References | 1 PubMed abstract 10804243 2 Chen H.-Y., Cheng J.-H., Huang C.-J.; "Molecular cloning and sequence analysis of cDNAs encoding crustaceanhyperglycemic hormone-like neuropeptides from the tiger prawn Penaeusmonodon."; Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases. |
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormone 2 |
| Mature Hormone Sequence | ANFDPSCAGVYNRELLGRLSRLCDDCYNVFREPKVATECRSNCFYNPVFVQCLEYLIPADLHEEYQAHVQTV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (45-116) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |