A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10575 |
| Swiss-prot Accession number | O97386 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormones 4 precursor (Pm-SGP-IV) [Contains:CHH precursor-related peptide 4 (CPRP 4); Crustacean hyperglycemichormone 4 (CHH 4)]. |
| Source organism | Penaeus monodon (Penoeid shrimp) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Penaeus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Protein Length | 120 Amino acids |
| Molecular weight | 12987 |
| References | 1 PubMed abstract 10804243 |
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormone 4 |
| Mature Hormone Sequence | SLFDPACTGIYDRQLLGKLGRLCDDCYNVFREPKVATGCRSNCYYNLIFLDCLEYLIPSHLQEEHMEALQTV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (47-118) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |