A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10579 |
| Swiss-prot Accession number | O15982 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormones 7 precursor (Pej-SGP-VII) [Contains:CHH precursor-related peptide 7 (CPRP 7); Crustacean hyperglycemichormone 7 (CHH 7)]. |
| Source organism | Penaeus japonicus (Kuruma prawn) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Marsupenaeus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released |
| Post translational modification | N/A |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Protein Length | 122 Amino acids |
| Molecular weight | 13583 |
| References | 1 Ohira T., Watanabe T., Nagasawa H., Aida K.; "Molecular cloning of cDNAs encoding four crustacean hyperglycemichormones and a molt-inhibiting hormone from the kuruma prawn Penaeusjaponicus."; (In) Proceedings of the XIII international congress of comparativeendocrinology, pp.83-86, Yokohama (1998).
|
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormones 7 |
| Mature Hormone Sequence | AAFDPSCTGVYDRELLGRLSRLCDDCYNVFREPKVAMECRSNCFFNPAFVQCLEYLIPAELHEEYQALVQTV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (49-120) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |