A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10581 |
| Swiss-prot Accession number | P30814 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormone (CHH). |
| Source organism | Armadillidium vulgare (Woodlice) (Pillbugs) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Peracarida; Isopoda; Oniscidea; Armadillidiidae;Armadillidium. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. Found also in the brain; in the neuroendocrine structures of the protocerebrum |
| Post translational modification | N/A |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Protein Length | 73 Amino acids |
| Molecular weight | 8736 |
| References | 1 PubMed abstract 8436119 2 PubMed abstract 12679090 |
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormone |
| Mature Hormone Sequence | RIFDTSCKGFYDRGLFAQLDRVCEDCYNLYRKPHVAAECRRDCYTTEVFESCLKDLMMHDFINEYKEMALMVS |
| Position of mature hormone in Pre-Hormone protein | 73 Residues from position (1-73) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |