A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10585 |
| Swiss-prot Accession number | O77220 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormones precursor [Contains: CHH precursor-related peptide (CPRP); Crustacean hyperglycemic hormone (CHH)]. |
| Source organism | Macrobrachium lanchesteri (Prawn) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Caridea;Palaemonoidea; Palaemonidae; Macrobrachium. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released (By similarity) |
| Post translational modification | N/A |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Protein Length | 135 Amino acids |
| Molecular weight | 15198 |
| References | 1 Ju B., Khoo H.-W.; "Characterization of crustacean hyperglycemic hormone (CHH) mRNAtranscripts and genomic sequences in Macrobrachium lanchesteri (deMan)."; Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormone |
| Mature Hormone Sequence | AILDQSCKGIFDRELFKKLDRVCDDCYNLYRKPYVAIDCREGCYQNLVFRQCIQDLQLMDQLDEYANAVQIV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (62-133) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |