A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10590 |
| Swiss-prot Accession number | P49926 (Sequence in FASTA format) |
| Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
| Source organism | Canis familiaris (Dog) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
| Protein Length | 196 Amino acids |
| Molecular weight | 21547 |
| References | 1 Kansaku N., Yamagishi K., Mizushima S.; "PCR cloning of dog corticotropin releasing hormone gene."; Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 7969821 |
| Domain Name | CRF |
| Hormone Name | Corticoliberin |
| Mature Hormone Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
| Position of mature hormone in Pre-Hormone protein | 41 Residues from position (154-194) |
| Receptor | N/A |
| Gene ID | 486977 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |