A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10593 |
| Swiss-prot Accession number | P19159 (Sequence in FASTA format) |
| Description | Chorionic somatomammotropin hormone 2 precursor (Placental lactogenII) (BPLP-II). |
| Source organism | Bos taurus (Bovine) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 238 Amino acids |
| Molecular weight | 27714 |
| References | 1 PubMed abstract 2341410 |
| Domain Name | Hormone_1 |
| Hormone Name | Chorionic somatomammotropin hormone 2 |
| Mature Hormone Sequence | ISCPSCGPDMFVSLQKSLIDVFINAASLSHDFHNLSTIMFNEFDEKYAQGKLYYINATKSCHTNSFHTPEERDKAQQMNNEDLSKWTLVLLYSWNNPLYYLLLELRNMKNLSEAVISSAMEIENMSEKLQAFIESQFRKIIVPVLKMIHEVSDTWSRFSSMTFSDEDRSISEYYNLFYCLRRDSRKVDMYIKILTCRTRKTC |
| Position of mature hormone in Pre-Hormone protein | 202 Residues from position (37-238) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |