A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10594 |
| Swiss-prot Accession number | P34207 (Sequence in FASTA format) |
| Description | Chorionic somatomammotropin hormone 1 variant precursor (Placentallactogen I variant) (PL-IV). |
| Source organism | Rattus norvegicus (Rat) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular location | Secreted protein |
| Developmental Stage | Predominantly synthesized during the later stage of gestation. |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N-glycosylated. |
| Function | N/A |
| Protein Length | 223 Amino acids |
| Molecular weight | 25844 |
| References | 1 Dai G., Deb S., Soares M.J.; Submitted (JUL-1995) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 15489334 3 PubMed abstract 1988439 |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin-3D4 |
| Mature Hormone Sequence | SKPTVLVSTEDLYHRLVEQSHNTFIKAADVYREFDINFAKRSWMKDRILPLCHTASIHVPENREEVHEIKTEDLLRSIINISVSWKEPLKHFVSAVTDLPGASASMRKKAVDMKDKNLIILEGLQKIFNRTQTKVEENENFDYPAWSGLKDLQSSDEDTHLFAIYNLCRCFKSDIHKIDTYLKVLRCRVVFKNEC |
| Position of mature hormone in Pre-Hormone protein | 195 Residues from position (29-223) |
| Receptor | N/A |
| Gene ID | 24282 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |