A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10599 |
| Swiss-prot Accession number | P67800 (Sequence in FASTA format) |
| Description | Diuretic hormone (DH) (Diuretic peptide) (DP). |
| Source organism | Musca domestica (House fly) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea;Muscidae; Musca. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Regulation of fluid secretion. Stimulates primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules. May act as clearance peptide in that it may remove metabolic waste from the hemolymph |
| Protein Length | 44 Amino acids |
| Molecular weight | 5181 |
| References | 1 PubMed abstract 7991460 |
| Domain Name | CRF |
| Hormone Name | Diuretic hormone |
| Mature Hormone Sequence | NKPSLSIVNPLDVLRQRLLLEIARRQMKENTRQVELNRAILKNV |
| Position of mature hormone in Pre-Hormone protein | 44 Residues from position (1-44) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |