A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10612 |
| Swiss-prot Accession number | P17685 (Sequence in FASTA format) |
| Description | ELH type 1 precursor [Contains: Alpha-bag cell peptide (Alpha-BCP);Beta-bag cell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP);Egg-laying hormone (ELH); Acidic peptide]. |
| Source organism | Aplysia parvula (Little sea hare) |
| Taxonomical Classification | Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the molluscan ELH family. |
| Tissue Specificity | Bag cell neurons |
| Post translational modification | N/A |
| Function | ELH acts as a neurotransmitter locally, upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string |
| Protein Length | 263 Amino acids |
| Molecular weight | 29676 |
| References | 1 PubMed abstract 3734873 |
| Domain Name | ELH |
| Hormone Name | Egg-laying hormone |
| Mature Hormone Sequence | ISINQDLKAIADMLIVEQKQEREKYLADLRQRLLNK |
| Position of mature hormone in Pre-Hormone protein | 36 Residues from position (198-233) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |