A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10616 |
| Swiss-prot Accession number | P13152 (Sequence in FASTA format) |
| Description | Glycoprotein hormones alpha chain 1 precursor (Gonadotropin 1 alphachain) (GTH-alpha) (Fragment). |
| Source organism | Oncorhynchus keta (Chum salmon) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Involved in gametogenesis and steroidogenesis |
| Protein Length | 108 Amino acids |
| Molecular weight | 12047 |
| References | 1 PubMed abstract 2466605 |
| Domain Name | Hormone_6 |
| Hormone Name | Glycoprotein hormones alpha chain 1 |
| Mature Hormone Sequence | YQNSDMTNVGCEECKLKENKVFSNPGAPVYQCTGCCFSRAYPTPLQSKKAMLVPKNITSEATCCVAKEGERVVVDNIKLTNHTECWCNTCYHHKS |
| Position of mature hormone in Pre-Hormone protein | 95 Residues from position (14-108) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |