A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10622 |
| Swiss-prot Accession number | P53542 (Sequence in FASTA format) |
| Description | Glycoprotein hormones alpha chain precursor (Gonadotropin alpha chain)(GTH-alpha). |
| Source organism | Clarias gariepinus (Sharptooth catfish) (African catfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Clariidae; Clarias. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Involved in gametogenesis and steroidogenesis |
| Protein Length | 116 Amino acids |
| Molecular weight | 13060 |
| References | 1 Rebers F.E.M., Tensen C.P., Schulz R.W., Goos H.J.T., Bogerd J.; Submitted (MAY-1996) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Hormone_6 |
| Hormone Name | Glycoprotein hormones alpha chain |
| Mature Hormone Sequence | YPNNDFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEVKRVIVNDVKLVNHTDCHCSTCYYHKF |
| Position of mature hormone in Pre-Hormone protein | 92 Residues from position (25-116) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |