A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10630 |
| Swiss-prot Accession number | P30984 (Sequence in FASTA format) |
| Description | Gonadotropin subunit beta-2 precursor (Gonadotropin beta-II chain)(GTH-II-beta) (Luteinizing hormone-like GTH) (Fragment). |
| Source organism | Ctenopharyngodon idella (Grass carp) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Ctenopharyngodon. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Involved in gametogenesis and steroidogenesis |
| Protein Length | 146 Amino acids |
| Molecular weight | 16320 |
| References | 1 Chang Y.S., Huang F.-L., Lo T.-B.; "The cDNA cloning and primary structures of grass carp gonadotropinsubunits."; Submitted (JUL-1991) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | Cys_knot |
| Hormone Name | Gonadotropin subunit beta-2 |
| Mature Hormone Sequence | SSFLPPCEPVNETVAVEKEGCPKCLVFQTTICSGHCLTKEPVYKSPFSTVYQHVCTYRDVRYETVRLPDCPPGVDPHITYPVALSCDCSLCTMDTSDCTIESLQPDFCMSQREDFPVY |
| Position of mature hormone in Pre-Hormone protein | 118 Residues from position (29-146) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |