A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10633 |
| Swiss-prot Accession number | P33088 (Sequence in FASTA format) |
| Description | Lutropin subunit beta (Luteinizing hormone subunit beta) (LSH-beta)(LSH-B) (LH-B) (Lutropin beta chain). |
| Source organism | Balaenoptera acutorostrata (Minke whale) (Lesser rorqual) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
| Protein Length | 118 Amino acids |
| Molecular weight | 12415 |
| References | 1 Karasev V.S., Pankov Y.A.; "Amino acid sequence of reduced and carboxymethylated alpha- and beta-subunits of the little picked whale luteinizing hormone."; Biokhimiia 50:1972-1986(1985).
|
| Domain Name | Cys_knot |
| Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
| Mature Hormone Sequence | PRGPLRPLCRPINATLAAZBZACPVCITFTTSICAGYCPSMVRVLPAALPPVPZPVCTYRZLRFASIRLPGCPPGVBPMVSFPVALSCHCGPCRLSSSBCGPGRAZPLACBRSPRPGL |
| Position of mature hormone in Pre-Hormone protein | 118 Residues from position (1-118) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |