A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10636 |
| Swiss-prot Accession number | P19794 (Sequence in FASTA format) |
| Description | Lutropin/choriogonadotropin subunit beta precursor (LSH-B/CG-B)(Luteinizing hormone subunit beta) (Lutropin/choriogonadotropin betachain). |
| Source organism | Equus asinus (Donkey) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
| Protein Length | 169 Amino acids |
| Molecular weight | 17943 |
| References | 1 Chopineau M., Combarnous Y., Allen W.R., Stewart F.; Submitted (JUL-1994) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 2344391 |
| Domain Name | Cys_knot |
| Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
| Mature Hormone Sequence | SRGPLRPLCRPINATLAAEKEACPICITFTTSICAGYCRSMVRVMPAALPPIPQPVCTYRELRFGSIRLPGCPPGVDPMVSFPVALSCHCGPCRLKTTDCGGPRDHPLACAPQTSSSCKDPPSQPLTSTSTPTPGASRRSSHPLPINTS |
| Position of mature hormone in Pre-Hormone protein | 149 Residues from position (21-169) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |