A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10650 |
| Swiss-prot Accession number | P55847 (Sequence in FASTA format) |
| Description | Molt-inhibiting hormone precursor (MIH) (PeJ-SGP-IV). |
| Source organism | Penaeus japonicus (Kuruma prawn) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Marsupenaeus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where it is stored and released |
| Post translational modification | N/A |
| Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops. Has little or no hyperglycemic activity |
| Protein Length | 105 Amino acids |
| Molecular weight | 12150 |
| References | 1 PubMed abstract 9450390 2 PubMed abstract 8801521 |
| Domain Name | Crust_neurohorm |
| Hormone Name | Molt-inhibiting hormone |
| Mature Hormone Sequence | SFIDNTCRGVMGNRDIYKKVVRVCEDCTNIFRLPGLDGMCRNRCFYNEWFLICLKAANREDEIEKFRVWISILNAGQ |
| Position of mature hormone in Pre-Hormone protein | 77 Residues from position (29-105) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | 1J0T |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |