A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10651 |
| Swiss-prot Accession number | P55322 (Sequence in FASTA format) |
| Description | Molt-inhibiting hormone-like precursor (MIH-like) (Fragment). |
| Source organism | Penaeus vannamei (Penoeid shrimp) (European white shrimp) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Litopenaeus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops |
| Protein Length | 102 Amino acids |
| Molecular weight | 11441 |
| References | 1 PubMed abstract 8055060 |
| Domain Name | Crust_neurohorm |
| Hormone Name | Molt-inhibiting hormone-like |
| Mature Hormone Sequence | DTFDHSCKGIYDRELFRKLDRVCEDCYNVFREPKVATECKSNCFVNKRFNVCVADLRHDVSRFLKMANSALS |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (31-102) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |