A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10653 |
| Swiss-prot Accession number | P56688 (Sequence in FASTA format) |
| Description | Mandibular organ-inhibiting hormone precursor (MOIH) [Contains: MOIHprecursor-related peptide; Mandibular organ-inhibiting hormone]. |
| Source organism | Libinia emarginata (Spider crab) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura;Eubrachyura; Majoidea; Majidae; Libinia. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where it is stored and released |
| Post translational modification | N/A |
| Function | Represses the synthesis of methyl farnesoate, the precursor of insect juvenile hormone III in the mandibular organ. Also has hyperglycemic activity |
| Protein Length | 137 Amino acids |
| Molecular weight | 15370 |
| References | 1 PubMed abstract 9783445 2 PubMed abstract 9299429 |
| Domain Name | Crust_neurohorm Crust_neuro_H |
| Hormone Name | Mandibular organ-inhibiting hormone |
| Mature Hormone Sequence | QIFDPSCKGLYDRGLFSDLEHVCKDCYNLYRNPQVTSACRVNCYSNRVFRQCMEDLLLMEDFDKYARAIQTV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (63-134) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |