A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10661 |
| Swiss-prot Accession number | P48144 (Sequence in FASTA format) |
| Description | Glucagon family neuropeptides precursor [Contains: Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH);Pituitary adenylate cyclase-activating polypeptide (PACAP)]. |
| Source organism | Clarias macrocephalus (Thai catfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Clariidae; Clarias. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | Brain, testis, ovary and stomach. Not pancreas, pituitary, muscle and liver |
| Post translational modification | N/A |
| Function | PACAP plays pivotal roles as a neurotransmitter and/or a neuromodulator |
| Protein Length | 195 Amino acids |
| Molecular weight | 22443 |
| References | 1 PubMed abstract 7758831 |
| Domain Name | Hormone_2 |
| Hormone Name | Pituitary adenylate cyclase-activating polypeptide |
| Mature Hormone Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNK |
| Position of mature hormone in Pre-Hormone protein | 38 Residues from position (130-167) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |